(data stored in ACNUC7421 zone)

EMBL: CP001600.PE3

CP001600.PE3         Location/Qualifiers
FT   CDS             2653..3729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0003"
FT                   /product="DNA replication and repair protein RecF,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67265"
FT                   /db_xref="GOA:C5BHC7"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHC7"
FT                   /protein_id="ACR67265.1"
FT                   /translation="MALTRLVIRDFRNIEEADLALAPGFNFLVGANGSGKTSVLEAIYT
FT                   LGHGRAFRSLQAGRVIRHDCSAFVLHGRIDDGGGRERAVGLSKDRQGDSKVRIDGSDGH
FT                   KVAELAQMLPMQLITPEGFTLLNGGPKYRRAFLDWGCFHGERSFFTAWNNLRRVLKQRN
FT                   AALRQVTRYAQIRPWDQELVPLAEQVSALRAAYSEAIAQDIAATCSQFLPEYALSFSFM
FT                   RGWDRESDYAALLERHFERDRALTYTAQGPHKADFRIRADGTPVEDLLSRGQLKLLMCA
FT                   LRLAQGEYLTRHSGRQCLYLIDDFASELDAGRRRLLAERLKSTGAQVFVSAVNADQIGD
FT                   MVDEKGKMFHVEQGKIAV"
     MALTRLVIRD FRNIEEADLA LAPGFNFLVG ANGSGKTSVL EAIYTLGHGR AFRSLQAGRV        60
     IRHDCSAFVL HGRIDDGGGR ERAVGLSKDR QGDSKVRIDG SDGHKVAELA QMLPMQLITP       120
     EGFTLLNGGP KYRRAFLDWG CFHGERSFFT AWNNLRRVLK QRNAALRQVT RYAQIRPWDQ       180
     ELVPLAEQVS ALRAAYSEAI AQDIAATCSQ FLPEYALSFS FMRGWDRESD YAALLERHFE       240
     RDRALTYTAQ GPHKADFRIR ADGTPVEDLL SRGQLKLLMC ALRLAQGEYL TRHSGRQCLY       300
     LIDDFASELD AGRRRLLAER LKSTGAQVFV SAVNADQIGD MVDEKGKMFH VEQGKIAV         358
//

If you have problems or comments...

PBIL Back to PBIL home page