(data stored in ACNUC7421 zone)

EMBL: CP001600.PE301

CP001600.PE301       Location/Qualifiers
FT   CDS             334331..334927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0330"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67572"
FT                   /db_xref="InterPro:IPR022260"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCW6"
FT                   /protein_id="ACR67572.1"
FT                   /translation="MKFYTRSKTLTAVLPLLLLAGCSSSPQKLQQRDAAVPTPSVAVTR
FT                   NVQTVAPDEYARMPEVVRYDRYLLVSTDPMAVQRDPLSQIIDIRIPAALHPTVADALRY
FT                   ALKQSGYSLCAMGPANGVLYRQPLPAVQYQLGPMRLRTALQVMAGPAWQLEVDDVQRVA
FT                   CHSLRDGYQLPASQLPPVLTSAKVPAPVKGGFLKK"
     MKFYTRSKTL TAVLPLLLLA GCSSSPQKLQ QRDAAVPTPS VAVTRNVQTV APDEYARMPE        60
     VVRYDRYLLV STDPMAVQRD PLSQIIDIRI PAALHPTVAD ALRYALKQSG YSLCAMGPAN       120
     GVLYRQPLPA VQYQLGPMRL RTALQVMAGP AWQLEVDDVQ RVACHSLRDG YQLPASQLPP       180
     VLTSAKVPAP VKGGFLKK                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page