(data stored in ACNUC7421 zone)

EMBL: CP001600.PE302

CP001600.PE302       Location/Qualifiers
FT   CDS             335047..335646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0331"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67573"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCW7"
FT                   /protein_id="ACR67573.1"
FT                   /translation="MLVNGVTDLDTRLSHLEAQDNTAKTTATLSSLQSQISTLQAGLAD
FT                   NQQRVTTLQKEIETRTAPSQALTTLQASAARLQQVQQEMEARLTTLVNQLNTLKTAPAA
FT                   AIPASEKTPTDVKKPLPVKPRTTAAVARHAPFVLTGVERRGAESWAAVAPRGYHSLSQI
FT                   ALIGEGETVSGWTLVRAGYSEATFRVNGRLIALKVE"
     MLVNGVTDLD TRLSHLEAQD NTAKTTATLS SLQSQISTLQ AGLADNQQRV TTLQKEIETR        60
     TAPSQALTTL QASAARLQQV QQEMEARLTT LVNQLNTLKT APAAAIPASE KTPTDVKKPL       120
     PVKPRTTAAV ARHAPFVLTG VERRGAESWA AVAPRGYHSL SQIALIGEGE TVSGWTLVRA       180
     GYSEATFRVN GRLIALKVE                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page