(data stored in ACNUC7421 zone)

EMBL: CP001600.PE304

CP001600.PE304       Location/Qualifiers
FT   CDS             336546..337001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0333"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67575"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCW9"
FT                   /protein_id="ACR67575.1"
FT                   /translation="MARPWPWTINVAGKEYRYSSRLEAWQALQVFMSRYSLKRIDVGLA
FT                   QVNLGWNGHHFTSTWAAFDPYTNLNAAAAILRECWERKPGSWLDAAGCYHHPAGGQAAV
FT                   RYKTIVKRHLVRISGSIRQSPPPLLPQTIVANAPEPGFIWTEPGSEP"
     MARPWPWTIN VAGKEYRYSS RLEAWQALQV FMSRYSLKRI DVGLAQVNLG WNGHHFTSTW        60
     AAFDPYTNLN AAAAILRECW ERKPGSWLDA AGCYHHPAGG QAAVRYKTIV KRHLVRISGS       120
     IRQSPPPLLP QTIVANAPEP GFIWTEPGSE P                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page