(data stored in ACNUC7421 zone)

EMBL: CP001600.PE305

CP001600.PE305       Location/Qualifiers
FT   CDS             337001..337513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0334"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67576"
FT                   /db_xref="InterPro:IPR021300"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX0"
FT                   /protein_id="ACR67576.1"
FT                   /translation="MKKLLLMICLFLPLMGYAGLNVIADLGGEDASPYFDGINKQPDLL
FT                   EASTATTLPPVSDMAAMFPVSTPEMAPGVVADRPLQLPGIGALFLIGDDVLSRSWLAEN
FT                   AQTLTDRHAVGMIISVDSASAVQSLRSLAPGVPMAPASGSELARRLQLRHYPVLISDTG
FT                   LSRQVRP"
     MKKLLLMICL FLPLMGYAGL NVIADLGGED ASPYFDGINK QPDLLEASTA TTLPPVSDMA        60
     AMFPVSTPEM APGVVADRPL QLPGIGALFL IGDDVLSRSW LAENAQTLTD RHAVGMIISV       120
     DSASAVQSLR SLAPGVPMAP ASGSELARRL QLRHYPVLIS DTGLSRQVRP                  170
//

If you have problems or comments...

PBIL Back to PBIL home page