(data stored in ACNUC7421 zone)

EMBL: CP001600.PE306

CP001600.PE306       Location/Qualifiers
FT   CDS             337554..338474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0335"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67577"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX1"
FT                   /protein_id="ACR67577.1"
FT                   /translation="MASLAVGGCVYRCNAVFKLSSTGKGLRSSSGAVFVSSGRKIMSDL
FT                   YLVEADNGCSFTDRVNRNLPAWAEHQIKAWDLTAFQQAEDFMTHHYWTDKGSINVFRIV
FT                   GTDHPQYAGMTWSELLQRGKRMDINIPLIEKKPEYYTDASVLHTSMSYVSLDGIHWYIS
FT                   ADGNHRSCLARFYFHLLGHSVTQLHNVSLSQYRADTVFMSACQDVLRLAPALRQKGVYL
FT                   TLTAHRLPVSREDTPGWKLDTFKTQVSVILDNVASDDDIRTFELHSATQAQHLLRQLES
FT                   ELMQPAVASAAPWWKRLLPFRREGV"
     MASLAVGGCV YRCNAVFKLS STGKGLRSSS GAVFVSSGRK IMSDLYLVEA DNGCSFTDRV        60
     NRNLPAWAEH QIKAWDLTAF QQAEDFMTHH YWTDKGSINV FRIVGTDHPQ YAGMTWSELL       120
     QRGKRMDINI PLIEKKPEYY TDASVLHTSM SYVSLDGIHW YISADGNHRS CLARFYFHLL       180
     GHSVTQLHNV SLSQYRADTV FMSACQDVLR LAPALRQKGV YLTLTAHRLP VSREDTPGWK       240
     LDTFKTQVSV ILDNVASDDD IRTFELHSAT QAQHLLRQLE SELMQPAVAS AAPWWKRLLP       300
     FRREGV                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page