(data stored in ACNUC7421 zone)

EMBL: CP001600.PE307

CP001600.PE307       Location/Qualifiers
FT   CDS             338708..340561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0336"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67578"
FT                   /db_xref="InterPro:IPR022458"
FT                   /db_xref="InterPro:IPR022503"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX2"
FT                   /protein_id="ACR67578.1"
FT                   /translation="MSAGQIPVSGQRLFLGRGFRWTQKHTQRLQDTLRPEVAKYLQPGR
FT                   LYLAARWLEMKTEHSAPGLGKLLRTDSPLNPVRPLPPVGGNPVLHGIEPDEQDVWLALL
FT                   ERVGHTIVYGTTRVGKTRLAELLVTQDIRRGEVTIVFDPKGDADLMKRVWAEAHRADRG
FT                   DALYIFHLGWPEISARYNAVGRFGRVSEVASRVAGQLSGEGNSAAFREFAWRFVNIIAR
FT                   ALVALGERPDYTLIMRYVNNIADLYIRYAEKVIREQLPSLQAQIQNNEQVLGDDDVPRN
FT                   MQGQPDAVRIWSIEVALSSEEGKQLYDPILDGLRSAVRYDRTYFDKIVASLLPLLEKLT
FT                   TGKTAELLAPDYLEMSDSRPIFDWEQIIRKKAVVYIGLDALSDSEVASAVGNSMFADLV
FT                   SVAGHIYKHGIHAGLPGEGESKVPVNLHCDEFNELMGDEFIPLINKGGGAGMQVTAYTQ
FT                   TSSDIEARIGNAAKTAQVQGNFNNLIMLRVRENRTAELLTTQLPQVEIYTKTLVSGHQD
FT                   TDISAGQDFTSSTQDRVGTVKVPLLEPADVVTLPKGQAFALLEGGQLWKIRMPLPADDA
FT                   DDTLMPQSIAKIAEEMRRNYHSGEAWWNDAPGIVPAGGVRG"
     MSAGQIPVSG QRLFLGRGFR WTQKHTQRLQ DTLRPEVAKY LQPGRLYLAA RWLEMKTEHS        60
     APGLGKLLRT DSPLNPVRPL PPVGGNPVLH GIEPDEQDVW LALLERVGHT IVYGTTRVGK       120
     TRLAELLVTQ DIRRGEVTIV FDPKGDADLM KRVWAEAHRA DRGDALYIFH LGWPEISARY       180
     NAVGRFGRVS EVASRVAGQL SGEGNSAAFR EFAWRFVNII ARALVALGER PDYTLIMRYV       240
     NNIADLYIRY AEKVIREQLP SLQAQIQNNE QVLGDDDVPR NMQGQPDAVR IWSIEVALSS       300
     EEGKQLYDPI LDGLRSAVRY DRTYFDKIVA SLLPLLEKLT TGKTAELLAP DYLEMSDSRP       360
     IFDWEQIIRK KAVVYIGLDA LSDSEVASAV GNSMFADLVS VAGHIYKHGI HAGLPGEGES       420
     KVPVNLHCDE FNELMGDEFI PLINKGGGAG MQVTAYTQTS SDIEARIGNA AKTAQVQGNF       480
     NNLIMLRVRE NRTAELLTTQ LPQVEIYTKT LVSGHQDTDI SAGQDFTSST QDRVGTVKVP       540
     LLEPADVVTL PKGQAFALLE GGQLWKIRMP LPADDADDTL MPQSIAKIAE EMRRNYHSGE       600
     AWWNDAPGIV PAGGVRG                                                      617
//

If you have problems or comments...

PBIL Back to PBIL home page