(data stored in ACNUC7421 zone)

EMBL: CP001600.PE308

CP001600.PE308       Location/Qualifiers
FT   CDS             340554..341309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0337"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67579"
FT                   /db_xref="GOA:C5BCX3"
FT                   /db_xref="InterPro:IPR022266"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX3"
FT                   /protein_id="ACR67579.1"
FT                   /translation="MAELQRNGPPQPRPEKPHDLLYNVFWGWPWALIGMLLGSLMLSLL
FT                   IEYTGIAFFWPEAGAAHSEAVMNTELGWLSTEFTRSLLLSEPSVTVSRWVTTAYQWLFV
FT                   DSGFTGWIKQHVLQTGSGNELTRNLSSWSGWLAGYLHEYLTATVWICVITLVRVTILVL
FT                   SVPLFLMVVLVALVEGLGRRDLRRYGAGYESSFVYHHAKKRVKPAIVVPIILYLSWPTA
FT                   VYPNLLLLPAAILLGVAITVTMASFKKYL"
     MAELQRNGPP QPRPEKPHDL LYNVFWGWPW ALIGMLLGSL MLSLLIEYTG IAFFWPEAGA        60
     AHSEAVMNTE LGWLSTEFTR SLLLSEPSVT VSRWVTTAYQ WLFVDSGFTG WIKQHVLQTG       120
     SGNELTRNLS SWSGWLAGYL HEYLTATVWI CVITLVRVTI LVLSVPLFLM VVLVALVEGL       180
     GRRDLRRYGA GYESSFVYHH AKKRVKPAIV VPIILYLSWP TAVYPNLLLL PAAILLGVAI       240
     TVTMASFKKY L                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page