(data stored in ACNUC7421 zone)

EMBL: CP001600.PE309

CP001600.PE309       Location/Qualifiers
FT   CDS             complement(341417..341881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0338"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67580"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX4"
FT                   /protein_id="ACR67580.1"
FT                   /translation="MANIAARARAVVIKGTELAHFENEVFSWHRINNQNGDEILPAVLI
FT                   TNAHPDYFMENSHGYKRETGLYRESKNNELKLILIPLKKFCPTTSDAISLIEKVFSDIK
FT                   EGKDLSDFRIAKKAQKGIGSAIVDSIILEPNIGGIGFKLNQLLSFLRKDK"
     MANIAARARA VVIKGTELAH FENEVFSWHR INNQNGDEIL PAVLITNAHP DYFMENSHGY        60
     KRETGLYRES KNNELKLILI PLKKFCPTTS DAISLIEKVF SDIKEGKDLS DFRIAKKAQK       120
     GIGSAIVDSI ILEPNIGGIG FKLNQLLSFL RKDK                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page