(data stored in ACNUC7421 zone)

EMBL: CP001600.PE310

CP001600.PE310       Location/Qualifiers
FT   CDS             342113..342454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0339"
FT                   /product="conserved hypothetical protein, RAQPRD motiff
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67581"
FT                   /db_xref="InterPro:IPR019110"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX5"
FT                   /protein_id="ACR67581.1"
FT                   /translation="MNHPHPVRSLSARIPGITGLLLLATLSTTVQAAEKDELASALRQL
FT                   DQVQASLERARVAAAQAAPAEQGRFFFDYRQATSDLNTIRIGIDRYLEPSRSQPRASFV
FT                   SGNYRRERP"
     MNHPHPVRSL SARIPGITGL LLLATLSTTV QAAEKDELAS ALRQLDQVQA SLERARVAAA        60
     QAAPAEQGRF FFDYRQATSD LNTIRIGIDR YLEPSRSQPR ASFVSGNYRR ERP              113
//

If you have problems or comments...

PBIL Back to PBIL home page