(data stored in ACNUC7421 zone)

EMBL: CP001600.PE311

CP001600.PE311       Location/Qualifiers
FT   CDS             342454..342696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0340"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67582"
FT                   /db_xref="GOA:C5BCX6"
FT                   /db_xref="InterPro:IPR021676"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX6"
FT                   /protein_id="ACR67582.1"
FT                   /translation="MGMTSAQSTAFKVASGNVEASILHLVCIGVLLAFLFLWAAWALSD
FT                   VWTGWSNEKVRNAALGRFAIRVVLLLVVSIWMFAS"
     MGMTSAQSTA FKVASGNVEA SILHLVCIGV LLAFLFLWAA WALSDVWTGW SNEKVRNAAL        60
     GRFAIRVVLL LVVSIWMFAS                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page