(data stored in ACNUC7421 zone)

EMBL: CP001600.PE312

CP001600.PE312       Location/Qualifiers
FT   CDS             342723..343109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0341"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67583"
FT                   /db_xref="GOA:C5BCX7"
FT                   /db_xref="InterPro:IPR021356"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX7"
FT                   /protein_id="ACR67583.1"
FT                   /translation="MHHSASVATHLRRDIDHVINRTFTWALLVWLICKPAFADLPTVEA
FT                   PTSNGGSGLMGQIKGYLQDGVVIGGLVVAAIAFINVAIAAVHTFTEVRNEKSTWTKFGS
FT                   IIVVGVVLLVAVLWLLGKSADIIL"
     MHHSASVATH LRRDIDHVIN RTFTWALLVW LICKPAFADL PTVEAPTSNG GSGLMGQIKG        60
     YLQDGVVIGG LVVAAIAFIN VAIAAVHTFT EVRNEKSTWT KFGSIIVVGV VLLVAVLWLL       120
     GKSADIIL                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page