(data stored in ACNUC7421 zone)

EMBL: CP001600.PE313

CP001600.PE313       Location/Qualifiers
FT   CDS             343119..343475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0342"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67584"
FT                   /db_xref="GOA:C5BCX8"
FT                   /db_xref="InterPro:IPR021877"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX8"
FT                   /protein_id="ACR67584.1"
FT                   /translation="MQTIRFLPDRLNSEPVVFRGFTTPEMGLASLAGLGVGLLLSLPFI
FT                   PLAGWVIIPTGMLLAPLLVIGFGGRWLSRIKRGKPENYIWQRLEAFKRRHSLGNPTLII
FT                   DARGWSLKRTGREK"
     MQTIRFLPDR LNSEPVVFRG FTTPEMGLAS LAGLGVGLLL SLPFIPLAGW VIIPTGMLLA        60
     PLLVIGFGGR WLSRIKRGKP ENYIWQRLEA FKRRHSLGNP TLIIDARGWS LKRTGREK         118
//

If you have problems or comments...

PBIL Back to PBIL home page