(data stored in ACNUC7421 zone)

EMBL: CP001600.PE314

CP001600.PE314       Location/Qualifiers
FT   CDS             343472..344131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0343"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67585"
FT                   /db_xref="GOA:C5BCX9"
FT                   /db_xref="InterPro:IPR021548"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX9"
FT                   /protein_id="ACR67585.1"
FT                   /translation="MSRFRHAVKDRDQHILTLRIVCGVLAFFLLITCAGWMLAPNKLTV
FT                   HNPPDLRAGSTRPWWEVPASSVYSFAFYIFQQLNAWPKNGEVDYPAKIHALSAYLTPGC
FT                   QDYLNTEARKRSNTGQLTDRVRVVYEIPGRGYQSKSVSVISRDNWVVRLDLVADEYFHA
FT                   EPVKRALVRYPLKVVRWEGDAERNPFGLALDCYDGVPQRLEAALPTEIPAKPGVFQ"
     MSRFRHAVKD RDQHILTLRI VCGVLAFFLL ITCAGWMLAP NKLTVHNPPD LRAGSTRPWW        60
     EVPASSVYSF AFYIFQQLNA WPKNGEVDYP AKIHALSAYL TPGCQDYLNT EARKRSNTGQ       120
     LTDRVRVVYE IPGRGYQSKS VSVISRDNWV VRLDLVADEY FHAEPVKRAL VRYPLKVVRW       180
     EGDAERNPFG LALDCYDGVP QRLEAALPTE IPAKPGVFQ                              219
//

If you have problems or comments...

PBIL Back to PBIL home page