(data stored in ACNUC7421 zone)

EMBL: CP001600.PE315

CP001600.PE315       Location/Qualifiers
FT   CDS             344131..345060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0344"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67586"
FT                   /db_xref="InterPro:IPR021844"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDH0"
FT                   /protein_id="ACR67586.1"
FT                   /translation="MKTRNDIRTGLMVLSLLLLPLVSLVSEPAQADEFMKWERIPLQIP
FT                   LQVGLERVVFVDKNVRVGFPPALNGKLRVQSTGGAVYLKADSTFPQTRVQLQDVESGEV
FT                   ILLDVTAGEKGPSEPVRLVYSGEVNTVSSTTDTRRQAENSDSSIQPGSDVGTQAKRKKV
FT                   SYGAPIPVLLTRYAAQSLYAPLRTVEAVPGIRPVNPHLPKRLTTLYPSEAITATPLAAW
FT                   GVANRVVVAVRLQNTASLRIVLDPRALQGQFVAATFQHRWLGPVGTPEDTTTVYIVTGM
FT                   RPESAFIAEPSVVRKAVRTAKKEISHAD"
     MKTRNDIRTG LMVLSLLLLP LVSLVSEPAQ ADEFMKWERI PLQIPLQVGL ERVVFVDKNV        60
     RVGFPPALNG KLRVQSTGGA VYLKADSTFP QTRVQLQDVE SGEVILLDVT AGEKGPSEPV       120
     RLVYSGEVNT VSSTTDTRRQ AENSDSSIQP GSDVGTQAKR KKVSYGAPIP VLLTRYAAQS       180
     LYAPLRTVEA VPGIRPVNPH LPKRLTTLYP SEAITATPLA AWGVANRVVV AVRLQNTASL       240
     RIVLDPRALQ GQFVAATFQH RWLGPVGTPE DTTTVYIVTG MRPESAFIAE PSVVRKAVRT       300
     AKKEISHAD                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page