(data stored in ACNUC7421 zone)

EMBL: CP001600.PE316

CP001600.PE316       Location/Qualifiers
FT   CDS             345050..346564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0345"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67587"
FT                   /db_xref="InterPro:IPR021207"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDH1"
FT                   /protein_id="ACR67587.1"
FT                   /translation="MQIKSNAMVKFIVPAVVVAGLVVGLKSCKGERLPENAENASGDVT
FT                   TVLKNLSQDELKALGVEGDTPEDTLRMLIGRLNDVRDRQKTLDKQNTDLLKENEQLRKR
FT                   GTNVSGQVDEAVQGLREEYDKRQQQLQNEQTSLLEKVQTLSEQLKTTVSSSAGAKQASD
FT                   SDIPLGLGLDGLGGRTRGIATRGDDGLMWVTPDDQKDVDPRDAASGKASPQFPTSFLDS
FT                   NPLTRQKAAYEQQVKGHTGEKGAQENAEPVYTLPENSTLVGSRAMTALLGRIPLNGTVT
FT                   DPYPFKVLIGKDNLTANGIELPDVEGAIVSGSASGDWTLSCVRGQVNSITFVFADGTVR
FT                   TVPQPEASGKSTGNGNTQNKTGTDGGIGWISDDDGIPCISGTRKSNASTYLPTIFALSA
FT                   AGAAGEAFGEGQYTTQNNVNGISSTLTGSAGEAALGKALSGGMSETTDWVKQRYGQTFD
FT                   AIYVPPGAKLAVHITRQLAIDYEDNGRRVRYDFTLPGGVSDNGGLD"
     MQIKSNAMVK FIVPAVVVAG LVVGLKSCKG ERLPENAENA SGDVTTVLKN LSQDELKALG        60
     VEGDTPEDTL RMLIGRLNDV RDRQKTLDKQ NTDLLKENEQ LRKRGTNVSG QVDEAVQGLR       120
     EEYDKRQQQL QNEQTSLLEK VQTLSEQLKT TVSSSAGAKQ ASDSDIPLGL GLDGLGGRTR       180
     GIATRGDDGL MWVTPDDQKD VDPRDAASGK ASPQFPTSFL DSNPLTRQKA AYEQQVKGHT       240
     GEKGAQENAE PVYTLPENST LVGSRAMTAL LGRIPLNGTV TDPYPFKVLI GKDNLTANGI       300
     ELPDVEGAIV SGSASGDWTL SCVRGQVNSI TFVFADGTVR TVPQPEASGK STGNGNTQNK       360
     TGTDGGIGWI SDDDGIPCIS GTRKSNASTY LPTIFALSAA GAAGEAFGEG QYTTQNNVNG       420
     ISSTLTGSAG EAALGKALSG GMSETTDWVK QRYGQTFDAI YVPPGAKLAV HITRQLAIDY       480
     EDNGRRVRYD FTLPGGVSDN GGLD                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page