(data stored in ACNUC7421 zone)

EMBL: CP001600.PE317

CP001600.PE317       Location/Qualifiers
FT   CDS             346754..346996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0346"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67588"
FT                   /db_xref="InterPro:IPR022262"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDH2"
FT                   /protein_id="ACR67588.1"
FT                   /translation="MRRPLTDNEQRKGTQDDRSYSRTQESEISQQFSRLPNPDMVMYLY
FT                   SHLAGGNTPVPGYSTVFPFYSQTQYAMPGERTEAL"
     MRRPLTDNEQ RKGTQDDRSY SRTQESEISQ QFSRLPNPDM VMYLYSHLAG GNTPVPGYST        60
     VFPFYSQTQY AMPGERTEAL                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page