(data stored in ACNUC7421 zone)

EMBL: CP001600.PE318

CP001600.PE318       Location/Qualifiers
FT   CDS             346996..349860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0347"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67589"
FT                   /db_xref="InterPro:IPR022303"
FT                   /db_xref="InterPro:IPR025955"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDH3"
FT                   /protein_id="ACR67589.1"
FT                   /translation="MFSLFGRKNEVKPDGTAGQPEGEVSPLVIHGREPLTRPGRMTRQE
FT                   EAKVYHANPSIIDYLPWVEFLDEDQCLLLEDGISVGAVYDVKPVATEGRTNDRLEQIRD
FT                   TVEDALQDSFDEYDENPWVVQFFCQDEDDAEAYLDHLRGYVKPHAQRTAFTEAWLGEMA
FT                   RHIRSISRPEGLFTDALITGQLWRGQQRRTRMVIYRWSGKSASRDPMPPVAMLNQACER
FT                   VVSALGGAGIRCTRQNGLQVHSWLLRLFNPSPDWVDKSTLYRQAAYADPRDFPAGVAPV
FT                   SNDFAETLWFTPPVSDPENGVWWIDNKLHCALPVERLRTPPEPGTITGEQARGEKKINA
FT                   LMDMFPEGTLLCMTIVVQPQDRLEEQFNRLSKNAVGENTESGRVRQDVKTVKEYLGNRH
FT                   KLYRAGITFLLRGDDMDNLKRKRLDLTTVLLGAGLQPVRSEFEVGPLNTWLRALPMCFN
FT                   PNSDKKHWYTRLTWVQHLAGLLPVTGRETGTGNPGFSFFNRGGDILTFDPLNKYDRTQN
FT                   AHLLLFGPTGAGKSATLCYAFSQLMAVHRPRLFIAEAGNSFGLQADYFESLGLSVNKIS
FT                   VKPGSGVSLPPFADAHKLVEEGLAAHAVDESDLPDIDADSDGEGEDEDKRDILGEMEIS
FT                   ARMMITGGDPKEEAEMKRADRAMIREALLMAAHATYKEGRQMLPSDLQKALYSIAGDDS
FT                   DEGQNVRNAQRKAKAAEMAEALGMFTQEGSFEAELFNREGELWPEADVTLVDLGHLARE
FT                   GYEAQMALTMVSMTNMINNIAERDQYLGRDIVFAVDEAHIVTVNPLLSPYMTKVVKMWR
FT                   KLGAWLWLATQNLKDFPDIAEKMLNMAEWWICLTMPPEEVKDISRFRALTPEQEAVLLS
FT                   ARKLSGCYTEGVVLAKRIEALFRAVPPSLYLALGMTEKEEKAERRALMREHHCSELDAA
FT                   KLIARKLDRLRGLTDAHDEESTAA"
     MFSLFGRKNE VKPDGTAGQP EGEVSPLVIH GREPLTRPGR MTRQEEAKVY HANPSIIDYL        60
     PWVEFLDEDQ CLLLEDGISV GAVYDVKPVA TEGRTNDRLE QIRDTVEDAL QDSFDEYDEN       120
     PWVVQFFCQD EDDAEAYLDH LRGYVKPHAQ RTAFTEAWLG EMARHIRSIS RPEGLFTDAL       180
     ITGQLWRGQQ RRTRMVIYRW SGKSASRDPM PPVAMLNQAC ERVVSALGGA GIRCTRQNGL       240
     QVHSWLLRLF NPSPDWVDKS TLYRQAAYAD PRDFPAGVAP VSNDFAETLW FTPPVSDPEN       300
     GVWWIDNKLH CALPVERLRT PPEPGTITGE QARGEKKINA LMDMFPEGTL LCMTIVVQPQ       360
     DRLEEQFNRL SKNAVGENTE SGRVRQDVKT VKEYLGNRHK LYRAGITFLL RGDDMDNLKR       420
     KRLDLTTVLL GAGLQPVRSE FEVGPLNTWL RALPMCFNPN SDKKHWYTRL TWVQHLAGLL       480
     PVTGRETGTG NPGFSFFNRG GDILTFDPLN KYDRTQNAHL LLFGPTGAGK SATLCYAFSQ       540
     LMAVHRPRLF IAEAGNSFGL QADYFESLGL SVNKISVKPG SGVSLPPFAD AHKLVEEGLA       600
     AHAVDESDLP DIDADSDGEG EDEDKRDILG EMEISARMMI TGGDPKEEAE MKRADRAMIR       660
     EALLMAAHAT YKEGRQMLPS DLQKALYSIA GDDSDEGQNV RNAQRKAKAA EMAEALGMFT       720
     QEGSFEAELF NREGELWPEA DVTLVDLGHL AREGYEAQMA LTMVSMTNMI NNIAERDQYL       780
     GRDIVFAVDE AHIVTVNPLL SPYMTKVVKM WRKLGAWLWL ATQNLKDFPD IAEKMLNMAE       840
     WWICLTMPPE EVKDISRFRA LTPEQEAVLL SARKLSGCYT EGVVLAKRIE ALFRAVPPSL       900
     YLALGMTEKE EKAERRALMR EHHCSELDAA KLIARKLDRL RGLTDAHDEE STAA             954
//

If you have problems or comments...

PBIL Back to PBIL home page