(data stored in ACNUC7421 zone)

EMBL: CP001600.PE319

CP001600.PE319       Location/Qualifiers
FT   CDS             349857..350249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0348"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67590"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDH4"
FT                   /protein_id="ACR67590.1"
FT                   /translation="MMTLKYPVPCVCGNDSPDNTVFTLPPQGEPGMSVVTQANLQRLSE
FT                   HIRQRLNGPVTVTCHPHRVGLSSCVAVTVEGRLRRAVNILITVSGQGSWPAEEEYEHPR
FT                   WYITVTDAADMVYLVLWLNNGVCQEL"
     MMTLKYPVPC VCGNDSPDNT VFTLPPQGEP GMSVVTQANL QRLSEHIRQR LNGPVTVTCH        60
     PHRVGLSSCV AVTVEGRLRR AVNILITVSG QGSWPAEEEY EHPRWYITVT DAADMVYLVL       120
     WLNNGVCQEL                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page