(data stored in ACNUC7421 zone)

EMBL: CP001600.PE322

CP001600.PE322       Location/Qualifiers
FT   CDS             complement(353102..355099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0351"
FT                   /product="Divergent AAA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67593"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDH7"
FT                   /protein_id="ACR67593.1"
FT                   /translation="MLQINDLTDLQTLTESVELECKLAQGKDGRGKLPDDFWPTYSAMA
FT                   NCRGGCVILGIKEKKGKFSVAGIQDISVVRKQLFDILSNKNKININLLTDKHISESIIE
FT                   GKNILVINIPPARREQKPIYLNNQPMTESWLRAHDGDHRCTEEQVRRMMAEQVEESRDN
FT                   RILQNFDMNDISQESLQAYRQLLSTSSPTHPALELDNFNFLRSIGGWRKDRQTGNEGMT
FT                   LAGILMFGTWESIQDAAPNYFVDYQERPEAKTERRWIDRLCPDGTWSGNVFDFYRRTYR
FT                   KLIADLKIPFELKDGIRQDDTQIHTALREALVNTLVHADYTGRLSIMVVKRPDLFGFRN
FT                   PGMMRIPPEQAIRGYESDCRNRLIHQMFLMIGAGERSGSGIPKIFSGWRWANWRVPRLY
FT                   EKAEPEQTLLELSIGNLVSEKTAALLYRIFGEQVNKLNELERGIVITTAVEGWIDHERA
FT                   CQLTTQHSREVTLTLPRLVCNGFLIAHGEKRNKSYTLPGHDLPSPEELFTLNPLSSLTS
FT                   KTAEFITDKGEMITDNDSLITDNNDVTTSDSHKRDHVGRFITDKLPAAYIDDFNFLSSS
FT                   LQRQLIDTASPAREKRRLPNDIMDKIILSLCQGHFMPLSVIAMLTKRTPQNIREKQLIP
FT                   LVKQGKLRLAFPHVRRHKKQGYMTVQTPTT"
     MLQINDLTDL QTLTESVELE CKLAQGKDGR GKLPDDFWPT YSAMANCRGG CVILGIKEKK        60
     GKFSVAGIQD ISVVRKQLFD ILSNKNKINI NLLTDKHISE SIIEGKNILV INIPPARREQ       120
     KPIYLNNQPM TESWLRAHDG DHRCTEEQVR RMMAEQVEES RDNRILQNFD MNDISQESLQ       180
     AYRQLLSTSS PTHPALELDN FNFLRSIGGW RKDRQTGNEG MTLAGILMFG TWESIQDAAP       240
     NYFVDYQERP EAKTERRWID RLCPDGTWSG NVFDFYRRTY RKLIADLKIP FELKDGIRQD       300
     DTQIHTALRE ALVNTLVHAD YTGRLSIMVV KRPDLFGFRN PGMMRIPPEQ AIRGYESDCR       360
     NRLIHQMFLM IGAGERSGSG IPKIFSGWRW ANWRVPRLYE KAEPEQTLLE LSIGNLVSEK       420
     TAALLYRIFG EQVNKLNELE RGIVITTAVE GWIDHERACQ LTTQHSREVT LTLPRLVCNG       480
     FLIAHGEKRN KSYTLPGHDL PSPEELFTLN PLSSLTSKTA EFITDKGEMI TDNDSLITDN       540
     NDVTTSDSHK RDHVGRFITD KLPAAYIDDF NFLSSSLQRQ LIDTASPARE KRRLPNDIMD       600
     KIILSLCQGH FMPLSVIAML TKRTPQNIRE KQLIPLVKQG KLRLAFPHVR RHKKQGYMTV       660
     QTPTT                                                                   665
//

If you have problems or comments...

PBIL Back to PBIL home page