(data stored in ACNUC7421 zone)

EMBL: CP001600.PE323

CP001600.PE323       Location/Qualifiers
FT   CDS             355278..355673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0352"
FT                   /product="Protein of unknown function (DUF1525)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67594"
FT                   /db_xref="InterPro:IPR011090"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDH8"
FT                   /protein_id="ACR67594.1"
FT                   /translation="MKLRDFILLPALLPVSVLAGTVVYTDSQHLPENLSPGVVAVLLDA
FT                   PERLQAKMFGQLSTDPEQAAAQVRLAMSSPQWQQKQQQLVAAYRQVVHAWELGIRKVPA
FT                   VVFDDRDVVYGTTDVAQALRLQAGGDQ"
     MKLRDFILLP ALLPVSVLAG TVVYTDSQHL PENLSPGVVA VLLDAPERLQ AKMFGQLSTD        60
     PEQAAAQVRL AMSSPQWQQK QQQLVAAYRQ VVHAWELGIR KVPAVVFDDR DVVYGTTDVA       120
     QALRLQAGGD Q                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page