(data stored in ACNUC7421 zone)

EMBL: CP001600.PE324

CP001600.PE324       Location/Qualifiers
FT   CDS             355670..356662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0353"
FT                   /product="Protein of unknown function (DUF1527)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67595"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="InterPro:IPR026331"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDH9"
FT                   /protein_id="ACR67595.1"
FT                   /translation="MNQPPSWFRRTLCSAAVATVLGTASIPTALAALNTAQIVASAVTQ
FT                   DCISWRVSGICYWLFCSWYGCTVRTSVKVTHFIPQTVVSTYVAPGGNPWTEMAAVSQTA
FT                   GGLENAVTGALSGVTAGGANPADMKNPGQRKSNIRFKYADAIGHPATSLIGGRIPGYSC
FT                   DSAATPLMPYFLSTLDSIAWRTGVPESLYPEALVIGRREIGSQASGNMWGNVYPRSGFV
FT                   SQSDDDKASAVVAQRVADIITRTGQPHVYHELKGPRRDGYWPPGEVTENTGSKNHKWQR
FT                   LAPSMTRSCAVFPDGSHSAASDNNAAFALWQPYSCCKRMGQKFLGSTDF"
     MNQPPSWFRR TLCSAAVATV LGTASIPTAL AALNTAQIVA SAVTQDCISW RVSGICYWLF        60
     CSWYGCTVRT SVKVTHFIPQ TVVSTYVAPG GNPWTEMAAV SQTAGGLENA VTGALSGVTA       120
     GGANPADMKN PGQRKSNIRF KYADAIGHPA TSLIGGRIPG YSCDSAATPL MPYFLSTLDS       180
     IAWRTGVPES LYPEALVIGR REIGSQASGN MWGNVYPRSG FVSQSDDDKA SAVVAQRVAD       240
     IITRTGQPHV YHELKGPRRD GYWPPGEVTE NTGSKNHKWQ RLAPSMTRSC AVFPDGSHSA       300
     ASDNNAAFAL WQPYSCCKRM GQKFLGSTDF                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page