(data stored in ACNUC7421 zone)

EMBL: CP001600.PE325

CP001600.PE325       Location/Qualifiers
FT   CDS             356809..358107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0354"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67596"
FT                   /db_xref="InterPro:IPR021204"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI0"
FT                   /protein_id="ACR67596.1"
FT                   /translation="MDGAVSDKLFYTLGGGSVISQPATRSNMKKLGMDIGWSSDLMCGN
FT                   FDLKTTVGNQLNGVTDGFKNLMGDVIQGATGAVASLPAMLIQRANPGLYDMLTNGVLQA
FT                   NVSFDKAQLNCQNMAKKMMDFSDTSKWTQAAMAEEYKSLVNNGETDAIRADQKYQDADG
FT                   TSGKKWIGGQIRGGKGQKAIRPTYDLVSAGYNMMNSLNVLSSETVSGASCNGGACSKFS
FT                   NAEEAAQAVVRVLGDRSMRTCSNALQCTSGDTDDQPGLSVAGTGFAPMLEEATKNNTEQ
FT                   LVKLVNGTVKPTATELAKLKTGGLPVTANVIRALQRDPDNTALTVRLASELAMSDAVET
FT                   ALLMRRMLTTGMSEPNAQDQPLALEDGVHRIDALDREIMALKNEMDLKRELARNSVLTI
FT                   IERDNERVGTNPMIQQTDNADSRFQKLDTPDAE"
     MDGAVSDKLF YTLGGGSVIS QPATRSNMKK LGMDIGWSSD LMCGNFDLKT TVGNQLNGVT        60
     DGFKNLMGDV IQGATGAVAS LPAMLIQRAN PGLYDMLTNG VLQANVSFDK AQLNCQNMAK       120
     KMMDFSDTSK WTQAAMAEEY KSLVNNGETD AIRADQKYQD ADGTSGKKWI GGQIRGGKGQ       180
     KAIRPTYDLV SAGYNMMNSL NVLSSETVSG ASCNGGACSK FSNAEEAAQA VVRVLGDRSM       240
     RTCSNALQCT SGDTDDQPGL SVAGTGFAPM LEEATKNNTE QLVKLVNGTV KPTATELAKL       300
     KTGGLPVTAN VIRALQRDPD NTALTVRLAS ELAMSDAVET ALLMRRMLTT GMSEPNAQDQ       360
     PLALEDGVHR IDALDREIMA LKNEMDLKRE LARNSVLTII ERDNERVGTN PMIQQTDNAD       420
     SRFQKLDTPD AE                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page