(data stored in ACNUC7421 zone)

EMBL: CP001600.PE329

CP001600.PE329       Location/Qualifiers
FT   CDS             360499..360996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0358"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67600"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI4"
FT                   /protein_id="ACR67600.1"
FT                   /translation="MDELSSVNKKISDFGVSIAGKQSSQNESGMPKLAPKVEADQDSTS
FT                   KDLSVPVDVDTAAARLRRYYKFMTTDELNSIKNRESTSARLTAAAIEEQRPEWSASVGS
FT                   YYKMGRNWGEGKDHITLEVEKNGAGSHVYIQFFSSNPQHLTEAYLGNLFAQVKDVAEGK
FT                   VR"
     MDELSSVNKK ISDFGVSIAG KQSSQNESGM PKLAPKVEAD QDSTSKDLSV PVDVDTAAAR        60
     LRRYYKFMTT DELNSIKNRE STSARLTAAA IEEQRPEWSA SVGSYYKMGR NWGEGKDHIT       120
     LEVEKNGAGS HVYIQFFSSN PQHLTEAYLG NLFAQVKDVA EGKVR                       165
//

If you have problems or comments...

PBIL Back to PBIL home page