(data stored in ACNUC7421 zone)

EMBL: CP001600.PE33

CP001600.PE33        Location/Qualifiers
FT   CDS             complement(31840..32460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0035"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67295"
FT                   /db_xref="GOA:C5B9B5"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9B5"
FT                   /protein_id="ACR67295.1"
FT                   /translation="MLLSILYIVGITAEAMTGALAAGRRQMDTFGVIIIASATAIGGGS
FT                   VRDMLLGHYPLSWVKHPENIMIVACAAVLTTWLAPLMSHLRRLFLLLDAVGLMVFSIIG
FT                   AQVALEMGHGPIIAVVAAVITGVFGGVLRDLFCNQIPLVFQKELYAGISFAAAWLYLGL
FT                   LYLQVPQDLTVIITLVAGFTARLLALRFHLSLPVFDYKQPERE"
     MLLSILYIVG ITAEAMTGAL AAGRRQMDTF GVIIIASATA IGGGSVRDML LGHYPLSWVK        60
     HPENIMIVAC AAVLTTWLAP LMSHLRRLFL LLDAVGLMVF SIIGAQVALE MGHGPIIAVV       120
     AAVITGVFGG VLRDLFCNQI PLVFQKELYA GISFAAAWLY LGLLYLQVPQ DLTVIITLVA       180
     GFTARLLALR FHLSLPVFDY KQPERE                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page