(data stored in ACNUC7421 zone)

EMBL: CP001600.PE330

CP001600.PE330       Location/Qualifiers
FT   CDS             361195..361818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0359"
FT                   /product="Uncharacterized protein family (UPF0153)"
FT                   /note="Uncharacterised protein family (UPF0153)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67601"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI5"
FT                   /protein_id="ACR67601.1"
FT                   /translation="MVESWHKCSEGVVDRIKNGKSLKSICQKGCSRCCSLHVSLLTPDV
FT                   FFIAENLTKDFSDSKLFFIKKRLKIRADKVEEYIDDSYRMECVFLGKTSGQCIIYKYRP
FT                   EACRRFFTNDEKDCIESNGSPLQDGAVFYSTGILSAYMALAAHNNDLFIDSHEVSKSLY
FT                   MALDRPLLFKKWLRGEPNVFPDVKWEGYHQEIKKMNADMKIKIK"
     MVESWHKCSE GVVDRIKNGK SLKSICQKGC SRCCSLHVSL LTPDVFFIAE NLTKDFSDSK        60
     LFFIKKRLKI RADKVEEYID DSYRMECVFL GKTSGQCIIY KYRPEACRRF FTNDEKDCIE       120
     SNGSPLQDGA VFYSTGILSA YMALAAHNND LFIDSHEVSK SLYMALDRPL LFKKWLRGEP       180
     NVFPDVKWEG YHQEIKKMNA DMKIKIK                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page