(data stored in ACNUC7421 zone)

EMBL: CP001600.PE331

CP001600.PE331       Location/Qualifiers
FT   CDS             363211..363765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0360"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67602"
FT                   /db_xref="GOA:C5BDI6"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR024456"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI6"
FT                   /protein_id="ACR67602.1"
FT                   /translation="MPLAPDEFYKAFQAVEKKNPGVAAAMQLSYALGLRTKEAVEACKS
FT                   VPSWKRALESGQNSVRVVFGTKGGRPRDTVILDRDSVRAAINYAEKVMEKQNGKLVDRP
FT                   DIRKAIDTYRYQVRQIGLTGKKAPHSMRYHFSQEAKSFYERQGYTEREIFAQVSMDLGH
FT                   GDGRGKYVRQVYFKELPDDNG"
     MPLAPDEFYK AFQAVEKKNP GVAAAMQLSY ALGLRTKEAV EACKSVPSWK RALESGQNSV        60
     RVVFGTKGGR PRDTVILDRD SVRAAINYAE KVMEKQNGKL VDRPDIRKAI DTYRYQVRQI       120
     GLTGKKAPHS MRYHFSQEAK SFYERQGYTE REIFAQVSMD LGHGDGRGKY VRQVYFKELP       180
     DDNG                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page