(data stored in ACNUC7421 zone)

EMBL: CP001600.PE332

CP001600.PE332       Location/Qualifiers
FT   CDS             363786..364208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67603"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI7"
FT                   /protein_id="ACR67603.1"
FT                   /translation="MRYDILMKATSVKPVYEIILEGNQCSEIVIAFNCETPLSESDTCA
FT                   MLARYFDNVYFEDNEHDTFTQKGDIFEMTGVIRVPPSEKTVHLNKGEVIIPITTRLTHQ
FT                   LMSQEYNARSEENVNGMVDNWIGDLFNKKGNLIINK"
     MRYDILMKAT SVKPVYEIIL EGNQCSEIVI AFNCETPLSE SDTCAMLARY FDNVYFEDNE        60
     HDTFTQKGDI FEMTGVIRVP PSEKTVHLNK GEVIIPITTR LTHQLMSQEY NARSEENVNG       120
     MVDNWIGDLF NKKGNLIINK                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page