(data stored in ACNUC7421 zone)

EMBL: CP001600.PE335

CP001600.PE335       Location/Qualifiers
FT   CDS             366567..367502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0364"
FT                   /product="Protein of unknown function (DUF1281)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67606"
FT                   /db_xref="InterPro:IPR009694"
FT                   /db_xref="InterPro:IPR023136"
FT                   /db_xref="InterPro:IPR041329"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ0"
FT                   /protein_id="ACR67606.1"
FT                   /translation="MSEWCQNRFEITGKSVCIDVLLQWINGADTPRYRHAILQSIQLFL
FT                   AGCAGILKPVRTVSYIPFQGLVRHGIGQSTAANLAFEQWLELLQKDVALDTETIRRIDR
FT                   LYHQSGLGALKWENIPLASRDIMATLMKRQYADWFGLAGMNDEPDAAACWERLREYPER
FT                   SQPCDMLMVIPTRLATELNGSGGLLAGISTTVSFYSHIYGMEWPAGHNVNLHRHAANGL
FT                   TLRLDSPWYPPSGEVVAGISALFECEVRHTYSEPVSGLSGYDCYDLGAHVDGHQGVPVE
FT                   TLPPAPALYLVSSEQPHPGPEMAGYSEVRG"
     MSEWCQNRFE ITGKSVCIDV LLQWINGADT PRYRHAILQS IQLFLAGCAG ILKPVRTVSY        60
     IPFQGLVRHG IGQSTAANLA FEQWLELLQK DVALDTETIR RIDRLYHQSG LGALKWENIP       120
     LASRDIMATL MKRQYADWFG LAGMNDEPDA AACWERLREY PERSQPCDML MVIPTRLATE       180
     LNGSGGLLAG ISTTVSFYSH IYGMEWPAGH NVNLHRHAAN GLTLRLDSPW YPPSGEVVAG       240
     ISALFECEVR HTYSEPVSGL SGYDCYDLGA HVDGHQGVPV ETLPPAPALY LVSSEQPHPG       300
     PEMAGYSEVR G                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page