(data stored in ACNUC7421 zone)

EMBL: CP001600.PE337

CP001600.PE337       Location/Qualifiers
FT   CDS             complement(368530..370116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67608"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ2"
FT                   /protein_id="ACR67608.1"
FT                   /translation="MCNKTLTLKKKSLQTVELPTDYDRLLQSITLLAPVQKVSLDIDVT
FT                   HKAALPAVIESALLLVAQLETVSPLELGGFFGLADHERQVLVDEMIDTGLVRYNDEGDI
FT                   ATTIRLTMQRREGAADEGIAIEDVENHRGFTFIDLCTGHIQPKCNADLQKGLPELARKI
FT                   NSSDFTDLIADQFRRFQVCLPDTKSMRALRSSKARLYRVNRASVGQSGLKQQISLDVHA
FT                   HSDPLNGIRLEARLMDYSSEHTRLMESSGLKTEAINWLHERKLEAATTTLEDYCDLAKD
FT                   TVIRRYIGRGGKLDLGRLLHDRQRRKTGYGDSATQRMIIGPVYAASNRDTLIKWAKWLP
FT                   LNQRTHQGVWLGATNELFGASLGFGSFIKQMNTELGSGERNSRLNLAFQCDEEYRAQRL
FT                   ITNLFNSRTDGSLRIFQKGRSESHLEMLVFPGEQGMAVVQYHAALDPSLGYAGLTLPIG
FT                   YFTTDPERVALLWAQVQQRIQSPLRSANQPEVVLDDLDQLLGCTSAELTQLLVDNSEEK
FT                   LKKLVEKFNQH"
     MCNKTLTLKK KSLQTVELPT DYDRLLQSIT LLAPVQKVSL DIDVTHKAAL PAVIESALLL        60
     VAQLETVSPL ELGGFFGLAD HERQVLVDEM IDTGLVRYND EGDIATTIRL TMQRREGAAD       120
     EGIAIEDVEN HRGFTFIDLC TGHIQPKCNA DLQKGLPELA RKINSSDFTD LIADQFRRFQ       180
     VCLPDTKSMR ALRSSKARLY RVNRASVGQS GLKQQISLDV HAHSDPLNGI RLEARLMDYS       240
     SEHTRLMESS GLKTEAINWL HERKLEAATT TLEDYCDLAK DTVIRRYIGR GGKLDLGRLL       300
     HDRQRRKTGY GDSATQRMII GPVYAASNRD TLIKWAKWLP LNQRTHQGVW LGATNELFGA       360
     SLGFGSFIKQ MNTELGSGER NSRLNLAFQC DEEYRAQRLI TNLFNSRTDG SLRIFQKGRS       420
     ESHLEMLVFP GEQGMAVVQY HAALDPSLGY AGLTLPIGYF TTDPERVALL WAQVQQRIQS       480
     PLRSANQPEV VLDDLDQLLG CTSAELTQLL VDNSEEKLKK LVEKFNQH                    528
//

If you have problems or comments...

PBIL Back to PBIL home page