(data stored in ACNUC7421 zone)

EMBL: CP001600.PE338

CP001600.PE338       Location/Qualifiers
FT   CDS             complement(370109..375070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0367"
FT                   /product="Nuclease-related domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67609"
FT                   /db_xref="GOA:C5BDJ3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ3"
FT                   /protein_id="ACR67609.1"
FT                   /translation="MKIHIAATQGLHQNEHDAIIAMEKALPAHWVGYAGILLVDKNRKS
FT                   LEFDVLIFAEDRILMVELKNFHGQIHMEDDQWIQTTPGGRKIKHGSPIDRKREHAQRIK
FT                   SMFDEELRALWGNTFYEIQALVVLTGEAKVTQQSPKDKGFVLALDEFLTIANLDTYFDK
FT                   MPETRAEGYFRRHPEKRPCAPGQIAIFEKWKRGGSYVQIRQRLEAGYVLSEKIPRLKGP
FT                   KGFYNEFDGEHERDLEDKSQIRMWDFSKMAHVGTDMSVRVFFGLREDRTQRHIRRTDSQ
FT                   LGKDYLLEPKHNLQEDTLTIDMAEVYQLPRLAERLDEFLVSSPLSIEKRTLLLRALLTP
FT                   LAGMHAMGVYHRDLSSKRLWWDRERNAIIISGLTSAKFPDLGHKSISDMRQDMDTTGIL
FT                   LPEDAFGETEVLGQAVDVFQLGVLCYQIAYGEQLTLPRDEPPQWKQPLNDPFEGKLDGF
FT                   IQQSLELDASKRHTDAGAMLETLTRTLNFQNLDSNEDKARVLDALAAFNTDAMPITEYP
FT                   QVETPSTDPQRQRMTFRSKTIDGQPCTVRIYLNARPNKDNHGQSQRLLHFLERCAIASN
FT                   NVLSLPPLIEFGCGMMGTHVVQSYALGESLEQWMTRPNRSYEERYQLADALIRAVHNLH
FT                   DLDLSHGDLKPENLLVQAEGGKLSILLLDMFDLDLDGLAPANSEYAPTTDVSATARDRY
FT                   AVYMIVDEIFAACIHHGANKIRGEIRNALGDKNAVPRSLDMLRRTMIHANEPELVEATP
FT                   LVIESLYFPNEQGELFEMDSGIYHLTASYTPKSNVLKLFFLGVSHKLTLNLKVDGQSLT
FT                   VHRMFYDRLGTGEIVYDTRNNRKNGNRAMSVGQPFIIKKGPFVAENTELLGFIRTLHVV
FT                   QHALDIKPESEEHPTVVAGDQEGYLKRLWLRLVEVERETLPTVKVIASPKELDGIVHVQ
FT                   INENIDSLEFAEDDVINVTMDDHETHFGQLDVAKSGNGVLVFSDDNRGNNFRLQNIRED
FT                   TILTLSNSGSDVSWERRDRALSRIVASDAVMGDLTDRFMNGPRGFQPPALPIPTDEQIN
FT                   RYGLDESKRAAFLYLLQNPLSVLMGPPGTGKTTLLSAALDYLLNDANVRRVLVVSQSHT
FT                   AVDEVANRVRELSFKRQEQSPDFKLPSIVRLGERRRVSEGMLDVHTNALQAQARTAFHR
FT                   DLEVRLLALSARLKLPEAFVLESAALYRACGRELFEFTPARNEVREAQQDGVDVDNLPN
FT                   DKRMIRLTTERRLDNLKNALIGRLSAFTDMPNQVLLHNKPLLAVLNMIAERHQINNPQR
FT                   IERMAEVIKVAHHWYQRLATDETGYAAFAARTRQLVVGTLVGIGHGGYQLDKNAFDLVV
FT                   IDEAARATFSELAIAMQSAKRVLLVGDYKQLAPSYDVSHVRQVARDLGLNEADVKRTDF
FT                   ERAYALNDGHMLSKQYRMAPAIGDIISHCFYDGTLATGRPPAPEWMSSLPTPWDRTVSW
FT                   IDTSDSKVLETNISKGIANEVEVNLLCSLLRQLVDDEQAMLQLRQWNDADTTPAIGIIT
FT                   GYRKQVELLQKRLESESWAAPIRSMMKVDTIDSYQGSENRIILLSLVRHNAEQKGGFMT
FT                   DNARVNVALSRAKERLLIIGAGSMWQQADACQPLARVFDYIHQQLPCQDSEYQIIRSAD
FT                   LTHNACTELQENDYV"
     MKIHIAATQG LHQNEHDAII AMEKALPAHW VGYAGILLVD KNRKSLEFDV LIFAEDRILM        60
     VELKNFHGQI HMEDDQWIQT TPGGRKIKHG SPIDRKREHA QRIKSMFDEE LRALWGNTFY       120
     EIQALVVLTG EAKVTQQSPK DKGFVLALDE FLTIANLDTY FDKMPETRAE GYFRRHPEKR       180
     PCAPGQIAIF EKWKRGGSYV QIRQRLEAGY VLSEKIPRLK GPKGFYNEFD GEHERDLEDK       240
     SQIRMWDFSK MAHVGTDMSV RVFFGLREDR TQRHIRRTDS QLGKDYLLEP KHNLQEDTLT       300
     IDMAEVYQLP RLAERLDEFL VSSPLSIEKR TLLLRALLTP LAGMHAMGVY HRDLSSKRLW       360
     WDRERNAIII SGLTSAKFPD LGHKSISDMR QDMDTTGILL PEDAFGETEV LGQAVDVFQL       420
     GVLCYQIAYG EQLTLPRDEP PQWKQPLNDP FEGKLDGFIQ QSLELDASKR HTDAGAMLET       480
     LTRTLNFQNL DSNEDKARVL DALAAFNTDA MPITEYPQVE TPSTDPQRQR MTFRSKTIDG       540
     QPCTVRIYLN ARPNKDNHGQ SQRLLHFLER CAIASNNVLS LPPLIEFGCG MMGTHVVQSY       600
     ALGESLEQWM TRPNRSYEER YQLADALIRA VHNLHDLDLS HGDLKPENLL VQAEGGKLSI       660
     LLLDMFDLDL DGLAPANSEY APTTDVSATA RDRYAVYMIV DEIFAACIHH GANKIRGEIR       720
     NALGDKNAVP RSLDMLRRTM IHANEPELVE ATPLVIESLY FPNEQGELFE MDSGIYHLTA       780
     SYTPKSNVLK LFFLGVSHKL TLNLKVDGQS LTVHRMFYDR LGTGEIVYDT RNNRKNGNRA       840
     MSVGQPFIIK KGPFVAENTE LLGFIRTLHV VQHALDIKPE SEEHPTVVAG DQEGYLKRLW       900
     LRLVEVERET LPTVKVIASP KELDGIVHVQ INENIDSLEF AEDDVINVTM DDHETHFGQL       960
     DVAKSGNGVL VFSDDNRGNN FRLQNIREDT ILTLSNSGSD VSWERRDRAL SRIVASDAVM      1020
     GDLTDRFMNG PRGFQPPALP IPTDEQINRY GLDESKRAAF LYLLQNPLSV LMGPPGTGKT      1080
     TLLSAALDYL LNDANVRRVL VVSQSHTAVD EVANRVRELS FKRQEQSPDF KLPSIVRLGE      1140
     RRRVSEGMLD VHTNALQAQA RTAFHRDLEV RLLALSARLK LPEAFVLESA ALYRACGREL      1200
     FEFTPARNEV REAQQDGVDV DNLPNDKRMI RLTTERRLDN LKNALIGRLS AFTDMPNQVL      1260
     LHNKPLLAVL NMIAERHQIN NPQRIERMAE VIKVAHHWYQ RLATDETGYA AFAARTRQLV      1320
     VGTLVGIGHG GYQLDKNAFD LVVIDEAARA TFSELAIAMQ SAKRVLLVGD YKQLAPSYDV      1380
     SHVRQVARDL GLNEADVKRT DFERAYALND GHMLSKQYRM APAIGDIISH CFYDGTLATG      1440
     RPPAPEWMSS LPTPWDRTVS WIDTSDSKVL ETNISKGIAN EVEVNLLCSL LRQLVDDEQA      1500
     MLQLRQWNDA DTTPAIGIIT GYRKQVELLQ KRLESESWAA PIRSMMKVDT IDSYQGSENR      1560
     IILLSLVRHN AEQKGGFMTD NARVNVALSR AKERLLIIGA GSMWQQADAC QPLARVFDYI      1620
     HQQLPCQDSE YQIIRSADLT HNACTELQEN DYV                                   1653
//

If you have problems or comments...

PBIL Back to PBIL home page