(data stored in ACNUC7421 zone)

EMBL: CP001600.PE339

CP001600.PE339       Location/Qualifiers
FT   CDS             375659..377131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0368"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67610"
FT                   /db_xref="GOA:C5BDJ4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ4"
FT                   /protein_id="ACR67610.1"
FT                   /translation="MTWKTTPEQNAIIEWRGNQLVVNAFAGTGKTTTLVQFAQANPESK
FT                   MLYLAYNRAIRDEAEQKFPFNVECKTSHQLAWSHFGRHFRHRLTANLRITDVARKLNTR
FT                   HWPLARLALTGLNAFLGSAESEPGIIHLPTEDERHGLSADKILGAVQALWYEVSRTESD
FT                   FPITHDVYLKLFQLSGPNLARKWDTLLFDEAQDANPVTSAFVLSQPCRIVLVGDRYQQI
FT                   YRFRGADNALSSPRLEQADRLWLTTSFRFGPAVAQMANMLLAMSGEEIKVTDSGEDDEV
FT                   VTHLPADVPHCSVLSRTVSGVIGAALSASLQEKKVFWVGGIEGYKTEELEDLYWFSADM
FT                   PERMQSPRLGQDYQDFDEYCAIAKATQDVEMNQAIRLLDEYFPLPQKLAIMRRQVVTHE
FT                   KDAQVTVSTAHRSKGLEWDVVVLNEDFCDISDPLLSAEERQDETNLLYVAVTRARKTLV
FT                   LNELMLFLKQKDCEQPVTGDAENDEGEVIFPC"
     MTWKTTPEQN AIIEWRGNQL VVNAFAGTGK TTTLVQFAQA NPESKMLYLA YNRAIRDEAE        60
     QKFPFNVECK TSHQLAWSHF GRHFRHRLTA NLRITDVARK LNTRHWPLAR LALTGLNAFL       120
     GSAESEPGII HLPTEDERHG LSADKILGAV QALWYEVSRT ESDFPITHDV YLKLFQLSGP       180
     NLARKWDTLL FDEAQDANPV TSAFVLSQPC RIVLVGDRYQ QIYRFRGADN ALSSPRLEQA       240
     DRLWLTTSFR FGPAVAQMAN MLLAMSGEEI KVTDSGEDDE VVTHLPADVP HCSVLSRTVS       300
     GVIGAALSAS LQEKKVFWVG GIEGYKTEEL EDLYWFSADM PERMQSPRLG QDYQDFDEYC       360
     AIAKATQDVE MNQAIRLLDE YFPLPQKLAI MRRQVVTHEK DAQVTVSTAH RSKGLEWDVV       420
     VLNEDFCDIS DPLLSAEERQ DETNLLYVAV TRARKTLVLN ELMLFLKQKD CEQPVTGDAE       480
     NDEGEVIFPC                                                              490
//

If you have problems or comments...

PBIL Back to PBIL home page