(data stored in ACNUC7421 zone)

EMBL: CP001600.PE340

CP001600.PE340       Location/Qualifiers
FT   CDS             377125..378717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0369"
FT                   /product="Protein of unknown function (DUF1528)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67611"
FT                   /db_xref="InterPro:IPR011093"
FT                   /db_xref="InterPro:IPR011119"
FT                   /db_xref="InterPro:IPR022391"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ5"
FT                   /protein_id="ACR67611.1"
FT                   /translation="MLNKIKTLLSRTPAVTEPSNKLPVSVPTGYFSPAKAEELVITALR
FT                   QDALQKIRENNALSAEVYQRFYLAPVLLLLERTQNVPAAPDGRWAYAGGFGDLSLRFTA
FT                   YAVRLARGYMFPPGAAPEEQAAQGVIWQAVIFWAALCYHLPLLASIEGETTGGVNWQPG
FT                   ISVPDAPYRFRFRHSPPNAHDASALAALAAGQLLPTEAINWLSGTPAALFSLACAFRNG
FT                   SPDMPLIRTLLDQAAEKVDSPVLRKETGGSSVVIAPPDSVTSQEGALVVQTDDNLSSSA
FT                   VELAASELMTPLNDTGGGDRQPPQNGVSTVESPEEPDNASPGLGDADMLLSLFSAVADA
FT                   EVSEVADDASVNTLATVAPDETVVVIGKDAPEESAETEESFRHRDTDSGGRLPGTHEEQ
FT                   SHPINVGADARRSGEVFLAWLSDGVASGRITVNQHDSRVHSVAGFIYLLVPDIFFLFLK
FT                   DTGSDSHREEIQTSFEKLQLHRVRRGERFIRAKLYCSENKQGRFSRVNGYLIKAVRLKG
FT                   VRPQEDSKLLFFP"
     MLNKIKTLLS RTPAVTEPSN KLPVSVPTGY FSPAKAEELV ITALRQDALQ KIRENNALSA        60
     EVYQRFYLAP VLLLLERTQN VPAAPDGRWA YAGGFGDLSL RFTAYAVRLA RGYMFPPGAA       120
     PEEQAAQGVI WQAVIFWAAL CYHLPLLASI EGETTGGVNW QPGISVPDAP YRFRFRHSPP       180
     NAHDASALAA LAAGQLLPTE AINWLSGTPA ALFSLACAFR NGSPDMPLIR TLLDQAAEKV       240
     DSPVLRKETG GSSVVIAPPD SVTSQEGALV VQTDDNLSSS AVELAASELM TPLNDTGGGD       300
     RQPPQNGVST VESPEEPDNA SPGLGDADML LSLFSAVADA EVSEVADDAS VNTLATVAPD       360
     ETVVVIGKDA PEESAETEES FRHRDTDSGG RLPGTHEEQS HPINVGADAR RSGEVFLAWL       420
     SDGVASGRIT VNQHDSRVHS VAGFIYLLVP DIFFLFLKDT GSDSHREEIQ TSFEKLQLHR       480
     VRRGERFIRA KLYCSENKQG RFSRVNGYLI KAVRLKGVRP QEDSKLLFFP                  530
//

If you have problems or comments...

PBIL Back to PBIL home page