(data stored in ACNUC7421 zone)

EMBL: CP001600.PE341

CP001600.PE341       Location/Qualifiers
FT   CDS             378778..379788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0370"
FT                   /product="site-specific recombinase, phage integrase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67612"
FT                   /db_xref="GOA:C5BDJ6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ6"
FT                   /protein_id="ACR67612.1"
FT                   /translation="MRNEITWDELLEEYFFAHRLRPATEWSYSKVVRGFRRYSCDTLPA
FT                   QITHRQVLEWRRYLLQDKQQSAQTWNNKIAHLRALYNYGMEYEILPPGKNPFNKSNVQR
FT                   DTRKKKTLTRSQLIRVYLVMQQFEEAERAGHGIRGGRNALWPAWYWLTVLDSFRYTGMR
FT                   LNQLLHIRLGDINLSEGYLDLCLEGSKTHREWRVPIVSALKPRLHHLTEKSTELGAGNE
FT                   DYLFDVNRIHLKRHMAWDAAKVYQKIRSFFRRLSKECGFAVSPHRFRHTLATELMKSPE
FT                   RNLQLVKDLLGHRSVSTTMEYVELKMDIVGKTLEAELSLHTDVTGERNLHLLTQA"
     MRNEITWDEL LEEYFFAHRL RPATEWSYSK VVRGFRRYSC DTLPAQITHR QVLEWRRYLL        60
     QDKQQSAQTW NNKIAHLRAL YNYGMEYEIL PPGKNPFNKS NVQRDTRKKK TLTRSQLIRV       120
     YLVMQQFEEA ERAGHGIRGG RNALWPAWYW LTVLDSFRYT GMRLNQLLHI RLGDINLSEG       180
     YLDLCLEGSK THREWRVPIV SALKPRLHHL TEKSTELGAG NEDYLFDVNR IHLKRHMAWD       240
     AAKVYQKIRS FFRRLSKECG FAVSPHRFRH TLATELMKSP ERNLQLVKDL LGHRSVSTTM       300
     EYVELKMDIV GKTLEAELSL HTDVTGERNL HLLTQA                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page