(data stored in ACNUC7421 zone)

EMBL: CP001600.PE342

CP001600.PE342       Location/Qualifiers
FT   CDS             380656..381294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0372"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67613"
FT                   /db_xref="InterPro:IPR021236"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ7"
FT                   /protein_id="ACR67613.1"
FT                   /translation="MKRILTATALSLAMFSTFTWAADAAPAASAATTAAAGMSAQQVQD
FT                   VAKVAQQGFTAMRDMQFARVALFRGSPEVATKLTDQAAGLLADDSTDWKAFIKSDKKAP
FT                   LAGDNYVIINASIALSEDFVATPEKQKAIARANEKLSKGDRKGALEELRLAGVGITETQ
FT                   YLMPLKQTRQAVAHAQSLLKAGKYYEANLALKGAEEGIITDSVTLAGGK"
     MKRILTATAL SLAMFSTFTW AADAAPAASA ATTAAAGMSA QQVQDVAKVA QQGFTAMRDM        60
     QFARVALFRG SPEVATKLTD QAAGLLADDS TDWKAFIKSD KKAPLAGDNY VIINASIALS       120
     EDFVATPEKQ KAIARANEKL SKGDRKGALE ELRLAGVGIT ETQYLMPLKQ TRQAVAHAQS       180
     LLKAGKYYEA NLALKGAEEG IITDSVTLAG GK                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page