(data stored in ACNUC7421 zone)

EMBL: CP001600.PE343

CP001600.PE343       Location/Qualifiers
FT   CDS             complement(381358..381933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0373"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67614"
FT                   /db_xref="GOA:C5BDJ8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ8"
FT                   /protein_id="ACR67614.1"
FT                   /translation="MQREQILTQALQRLERHGLAGATLPALIDSEMLSLDQARRYWPDS
FT                   EALLYDCLRFHSQQIDTWRRQLLLNDTLSHDDKILARYSVLAEHVEQGRFPGCLFISAC
FT                   IQYPVTDHPIHQLASRQKQASFDFTLQLLQESEIDDASLVAHQMELVQEGCLNRLLVSR
FT                   RREDVDIALHLAQDILHIAHCRRHDALS"
     MQREQILTQA LQRLERHGLA GATLPALIDS EMLSLDQARR YWPDSEALLY DCLRFHSQQI        60
     DTWRRQLLLN DTLSHDDKIL ARYSVLAEHV EQGRFPGCLF ISACIQYPVT DHPIHQLASR       120
     QKQASFDFTL QLLQESEIDD ASLVAHQMEL VQEGCLNRLL VSRRREDVDI ALHLAQDILH       180
     IAHCRRHDAL S                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page