(data stored in ACNUC7421 zone)

EMBL: CP001600.PE344

CP001600.PE344       Location/Qualifiers
FT   CDS             complement(381965..383692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0374"
FT                   /product="thiol:disulfide interchange protein DsbD,
FT                   putative"
FT                   /EC_number="1.8.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67615"
FT                   /db_xref="GOA:C5BDJ9"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ9"
FT                   /protein_id="ACR67615.1"
FT                   /translation="MAQRIFALIALFITTLLPAQASLFGGQPRFVPVNQAFAFDFQQRG
FT                   ESLTLRWQIQPGYYLYRQQIRITPHQAQLGHWQLPPGIPHHDEFQGETAIFRDGLSLTL
FT                   PLLSAAAGGEVSVTYQGCAAAGFCYPPETRRIPLKAITAAVGVLPPPGTAAMATANTEH
FT                   APTLPFPALWALLIGIGIAFTPCVLPMYPLISALILGQKQRHGWGHTALLALVYVQGMA
FT                   ITYTVLGMVVAAAGLRFQAAFQHPYVLIGLSLLFILLALSMFGAFTLQLPASLQTRLTL
FT                   WSNRQRSGSLLGVFVMGALAGLICSPCTTAPLSAILLYIAQNGNLWVGGGTLYLYALGM
FT                   GIPLIAVTLFGNRLLPRSGPWMQHVKEGFGFVILALPVFLLERILGDAWGARLWSLLGI
FT                   TFFLWGFSLSLHARRRGTRLWQILLLGAALICARPLQDWIFDETPRASIGVSAPLAFQP
FT                   IDSPQQLTQALAQAKARRQPVMLDFYADWCTACKEFEKYTFSNDAVRSQLAGTLLLQAN
FT                   VTANTEQHAQLLQQLNVLGLPSILFFTPDGQPLDDARVTGFMDAKRFLAHLQQLPYAQ"
     MAQRIFALIA LFITTLLPAQ ASLFGGQPRF VPVNQAFAFD FQQRGESLTL RWQIQPGYYL        60
     YRQQIRITPH QAQLGHWQLP PGIPHHDEFQ GETAIFRDGL SLTLPLLSAA AGGEVSVTYQ       120
     GCAAAGFCYP PETRRIPLKA ITAAVGVLPP PGTAAMATAN TEHAPTLPFP ALWALLIGIG       180
     IAFTPCVLPM YPLISALILG QKQRHGWGHT ALLALVYVQG MAITYTVLGM VVAAAGLRFQ       240
     AAFQHPYVLI GLSLLFILLA LSMFGAFTLQ LPASLQTRLT LWSNRQRSGS LLGVFVMGAL       300
     AGLICSPCTT APLSAILLYI AQNGNLWVGG GTLYLYALGM GIPLIAVTLF GNRLLPRSGP       360
     WMQHVKEGFG FVILALPVFL LERILGDAWG ARLWSLLGIT FFLWGFSLSL HARRRGTRLW       420
     QILLLGAALI CARPLQDWIF DETPRASIGV SAPLAFQPID SPQQLTQALA QAKARRQPVM       480
     LDFYADWCTA CKEFEKYTFS NDAVRSQLAG TLLLQANVTA NTEQHAQLLQ QLNVLGLPSI       540
     LFFTPDGQPL DDARVTGFMD AKRFLAHLQQ LPYAQ                                  575
//

If you have problems or comments...

PBIL Back to PBIL home page