(data stored in ACNUC7421 zone)

EMBL: CP001600.PE348

CP001600.PE348       Location/Qualifiers
FT   CDS             387391..387867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0378"
FT                   /product="FxsA cytoplasmic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67619"
FT                   /db_xref="GOA:C5BDK3"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDK3"
FT                   /protein_id="ACR67619.1"
FT                   /translation="MRWLPFILIFFYVYIEISIFIKVAAVLGVALTLLLVILTSCLGAS
FT                   LVRNQGMKTLMQMQQKLAMGESPAAEMIKSVSLVMAGLLLLLPGFCTDLLGLLLMLPLV
FT                   QKRLALKLLPYFRIYRSSGPGDGGGFGGGPGGGGHTFDGEFERKDDDRQRLDNK"
     MRWLPFILIF FYVYIEISIF IKVAAVLGVA LTLLLVILTS CLGASLVRNQ GMKTLMQMQQ        60
     KLAMGESPAA EMIKSVSLVM AGLLLLLPGF CTDLLGLLLM LPLVQKRLAL KLLPYFRIYR       120
     SSGPGDGGGF GGGPGGGGHT FDGEFERKDD DRQRLDNK                               158
//

If you have problems or comments...

PBIL Back to PBIL home page