(data stored in ACNUC7421 zone)

EMBL: CP001600.PE351

CP001600.PE351       Location/Qualifiers
FT   CDS             390331..390678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0381"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67622"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDK6"
FT                   /protein_id="ACR67622.1"
FT                   /translation="MRIKGLLGLAAIMLLAGCSTMTQLSSSGQQVKFTDAKPGTECQLL
FT                   GEAVGTQSNWLSGQGGETSSMRAAANDLRNKAAAMGGNVVYGAVSPSESFWSSFAPLDS
FT                   KMSGQVYKCPN"
     MRIKGLLGLA AIMLLAGCST MTQLSSSGQQ VKFTDAKPGT ECQLLGEAVG TQSNWLSGQG        60
     GETSSMRAAA NDLRNKAAAM GGNVVYGAVS PSESFWSSFA PLDSKMSGQV YKCPN            115
//

If you have problems or comments...

PBIL Back to PBIL home page