(data stored in ACNUC7421 zone)

EMBL: CP001600.PE352

CP001600.PE352       Location/Qualifiers
FT   CDS             complement(390762..391457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0382"
FT                   /product="hypothetical protein"
FT                   /note="Uncharacterized ACR, YkgG family COG1556"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67623"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDK7"
FT                   /protein_id="ACR67623.1"
FT                   /translation="MNNRDEFLATIARQLGREVRHIPQPRPQPINDYAQTRLTGLSVQQ
FT                   RCDAFIDVASNVMLAHCERCSEADAAQAALHLCQRYGQTPTIVSGDGRLAQLGITETLV
FT                   RECPATVWDPALGAENLRMAEQAKVGVVYAEYGLAESGGVVLFSSALHGRALSLLPESS
FT                   IFVLRKSTILPRVAQLASLLHQRAQRGGRMPSCINLIGGPSSTADIELIKVIGVHGPVN
FT                   AAYLIVEDC"
     MNNRDEFLAT IARQLGREVR HIPQPRPQPI NDYAQTRLTG LSVQQRCDAF IDVASNVMLA        60
     HCERCSEADA AQAALHLCQR YGQTPTIVSG DGRLAQLGIT ETLVRECPAT VWDPALGAEN       120
     LRMAEQAKVG VVYAEYGLAE SGGVVLFSSA LHGRALSLLP ESSIFVLRKS TILPRVAQLA       180
     SLLHQRAQRG GRMPSCINLI GGPSSTADIE LIKVIGVHGP VNAAYLIVED C                231
//

If you have problems or comments...

PBIL Back to PBIL home page