(data stored in ACNUC7421 zone)

EMBL: CP001600.PE353

CP001600.PE353       Location/Qualifiers
FT   CDS             complement(391457..392878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0383"
FT                   /product="iron-sulfur cluster-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67624"
FT                   /db_xref="GOA:C5BDK8"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDK8"
FT                   /protein_id="ACR67624.1"
FT                   /translation="MSLKTSDVKFKDRIRLQLDDAVMRKAVANAQERISANRQKMVDEL
FT                   GHWDEWRERAEQIRDHVLDNLDAYLYQLAEKVTENGGKVYFAKTKEDATRYILQVAQGK
FT                   NAKKVVKAKSMVTEEIGMNHALQQAGIQVVETDLGEYILQLDQDPPSHVVVPAIHKDRT
FT                   QIRRVLHETLGYDGPETPEAMTLFIRQKIRQDFLSADIGVTGCNFAVAETGSVCLVTNE
FT                   GNARMCTTLPPTHIAVMGMERIAPTFEEVDVLITMLARSAVGARLTGYNTWLTGPREAD
FT                   NLDGPQEFHLVIVDNGRSSILGSPFRAVLRCIRCGACMNTCPAYRHIGGHGYGSIYPGP
FT                   IGAVISPLLGGYANFKDLPYACSLCTACDSVCPVNIPLSKLILRHRRAMVEAGLPPKAE
FT                   QRATRLFAYANSHPTLWKVGMIAGARVASWLIKGGKAPINAGALAEWTAARDLPQADGE
FT                   SFRSWFKQHKEQGNK"
     MSLKTSDVKF KDRIRLQLDD AVMRKAVANA QERISANRQK MVDELGHWDE WRERAEQIRD        60
     HVLDNLDAYL YQLAEKVTEN GGKVYFAKTK EDATRYILQV AQGKNAKKVV KAKSMVTEEI       120
     GMNHALQQAG IQVVETDLGE YILQLDQDPP SHVVVPAIHK DRTQIRRVLH ETLGYDGPET       180
     PEAMTLFIRQ KIRQDFLSAD IGVTGCNFAV AETGSVCLVT NEGNARMCTT LPPTHIAVMG       240
     MERIAPTFEE VDVLITMLAR SAVGARLTGY NTWLTGPREA DNLDGPQEFH LVIVDNGRSS       300
     ILGSPFRAVL RCIRCGACMN TCPAYRHIGG HGYGSIYPGP IGAVISPLLG GYANFKDLPY       360
     ACSLCTACDS VCPVNIPLSK LILRHRRAMV EAGLPPKAEQ RATRLFAYAN SHPTLWKVGM       420
     IAGARVASWL IKGGKAPINA GALAEWTAAR DLPQADGESF RSWFKQHKEQ GNK              473
//

If you have problems or comments...

PBIL Back to PBIL home page