(data stored in ACNUC7421 zone)

EMBL: CP001600.PE354

CP001600.PE354       Location/Qualifiers
FT   CDS             complement(392889..393608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0384"
FT                   /product="Cysteine-rich domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67625"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDK9"
FT                   /protein_id="ACR67625.1"
FT                   /translation="MNVNFFVTCLGDALKSRMARDSVLLLEQLGCTVHFPEKQGCCSQP
FT                   AINGGYVEDAIPGMKTLIRALEENDDPIISPAGSCTYAVKSYPSYLSDEPGWALRAERV
FT                   ANRMVDLTSFIVNSLGVQDVGAHLPGRAVYHPSCSLLRKMKVRDEPLTLLSHVRGLELL
FT                   PFPAAETCCGFGGTFSIKMAEISGEMVKEKVSHMMEAQPEYLIGADISCLINIGGRLQR
FT                   EGLPVKVMHIAEVLMSR"
     MNVNFFVTCL GDALKSRMAR DSVLLLEQLG CTVHFPEKQG CCSQPAINGG YVEDAIPGMK        60
     TLIRALEEND DPIISPAGSC TYAVKSYPSY LSDEPGWALR AERVANRMVD LTSFIVNSLG       120
     VQDVGAHLPG RAVYHPSCSL LRKMKVRDEP LTLLSHVRGL ELLPFPAAET CCGFGGTFSI       180
     KMAEISGEMV KEKVSHMMEA QPEYLIGADI SCLINIGGRL QREGLPVKVM HIAEVLMSR        239
//

If you have problems or comments...

PBIL Back to PBIL home page