(data stored in ACNUC7421 zone)

EMBL: CP001600.PE356

CP001600.PE356       Location/Qualifiers
FT   CDS             complement(395450..396478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0386"
FT                   /product="KamA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67627"
FT                   /db_xref="GOA:C5BDL1"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDL1"
FT                   /protein_id="ACR67627.1"
FT                   /translation="MAHIITQKGQPREDWLQQLADVVTDPADLLAQLGLSDHPQWLAGC
FT                   EARRLFPLRVPHAFISRIRRGDPNDPLLRQVMSDAAEFIETPGFSTDPLAEQHSVVPGL
FT                   LHKYQNRALLLVKGSCAVNCRYCFRRHFPYQENQGTRANWQRAVAYLCEHPELDEIIFS
FT                   GGDPLMAKDHELDWLFTQLEQLPHLRRLRIHSRLPVVIPARVTDALCQRMADSRLQMIL
FT                   VTHINHANEIDEALSEAMERLKQAGVTLLNQSVLLRGINDNADTLAALSNALFEAGILP
FT                   YYLHVLDKVQGGAHFMVPDDEARRLMNGLLSRVSGYLVPRLTREIGGEPSKTPLDLHLR
FT                   QQ"
     MAHIITQKGQ PREDWLQQLA DVVTDPADLL AQLGLSDHPQ WLAGCEARRL FPLRVPHAFI        60
     SRIRRGDPND PLLRQVMSDA AEFIETPGFS TDPLAEQHSV VPGLLHKYQN RALLLVKGSC       120
     AVNCRYCFRR HFPYQENQGT RANWQRAVAY LCEHPELDEI IFSGGDPLMA KDHELDWLFT       180
     QLEQLPHLRR LRIHSRLPVV IPARVTDALC QRMADSRLQM ILVTHINHAN EIDEALSEAM       240
     ERLKQAGVTL LNQSVLLRGI NDNADTLAAL SNALFEAGIL PYYLHVLDKV QGGAHFMVPD       300
     DEARRLMNGL LSRVSGYLVP RLTREIGGEP SKTPLDLHLR QQ                          342
//

If you have problems or comments...

PBIL Back to PBIL home page