(data stored in ACNUC7421 zone)

EMBL: CP001600.PE359

CP001600.PE359       Location/Qualifiers
FT   CDS             complement(397671..398030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0389"
FT                   /product="fumarate reductase, subunit D, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67630"
FT                   /db_xref="GOA:C5BDL4"
FT                   /db_xref="InterPro:IPR003418"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BDL4"
FT                   /protein_id="ACR67630.1"
FT                   /translation="MMNNKVYKRSDEPVFWGLFGAGGMWGAIFAPAVILIVGILLPLGM
FT                   FPDALTFERALSFSQSIIGRIFWLLMIILPLWCGLHRLHHMMHDLKIHVPASSWVFYGL
FT                   AAILSVVALIGIFTL"
     MMNNKVYKRS DEPVFWGLFG AGGMWGAIFA PAVILIVGIL LPLGMFPDAL TFERALSFSQ        60
     SIIGRIFWLL MIILPLWCGL HRLHHMMHDL KIHVPASSWV FYGLAAILSV VALIGIFTL        119
//

If you have problems or comments...

PBIL Back to PBIL home page