(data stored in ACNUC7421 zone)

EMBL: CP001600.PE360

CP001600.PE360       Location/Qualifiers
FT   CDS             complement(398044..398442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0390"
FT                   /product="fumarate reductase, subunit C, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67631"
FT                   /db_xref="GOA:C5BDL5"
FT                   /db_xref="InterPro:IPR003510"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDL5"
FT                   /protein_id="ACR67631.1"
FT                   /translation="MTTSTKRKPYVRGMSSNWWHKLGFYKFYMLRESSALENVWFSIVL
FT                   IYGVFSLKDGAAGWESFVAFLQNPLVLVLNIISLLLAVLHTKTWFELAPKAANIVVNDE
FT                   KMGPAPIIKALWVVTIVVTVVVLGLALL"
     MTTSTKRKPY VRGMSSNWWH KLGFYKFYML RESSALENVW FSIVLIYGVF SLKDGAAGWE        60
     SFVAFLQNPL VLVLNIISLL LAVLHTKTWF ELAPKAANIV VNDEKMGPAP IIKALWVVTI       120
     VVTVVVLGLA LL                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page