(data stored in ACNUC7421 zone)

EMBL: CP001600.PE361

CP001600.PE361       Location/Qualifiers
FT   CDS             complement(398459..399193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0391"
FT                   /product="fumarate reductase, iron-sulfur subunit,
FT                   putative"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67632"
FT                   /db_xref="GOA:C5BDL6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDL6"
FT                   /protein_id="ACR67632.1"
FT                   /translation="MAEMKNLKMEVMRYNPEQDAEPRFVTYEVPYDDATSLLDALLYVK
FT                   DNLAPDLSFRWSCRMAICGSCGMMVDNVPKLACKTFLRDYPNGMRVEALANFPVERDLV
FT                   VDMTHFIESLEAIKPYVIGNDRKPEEGTNKQTPAEMEKYHQFSGCINCGLCYAACPQFG
FT                   LNPEFIGPAAITLAHRYNLDNRDHGKKERMPVLNTQNGVWSCTFVGYCSEVCPKHVDPA
FT                   AAIQQGKVESAKDFMIAMLKPQ"
     MAEMKNLKME VMRYNPEQDA EPRFVTYEVP YDDATSLLDA LLYVKDNLAP DLSFRWSCRM        60
     AICGSCGMMV DNVPKLACKT FLRDYPNGMR VEALANFPVE RDLVVDMTHF IESLEAIKPY       120
     VIGNDRKPEE GTNKQTPAEM EKYHQFSGCI NCGLCYAACP QFGLNPEFIG PAAITLAHRY       180
     NLDNRDHGKK ERMPVLNTQN GVWSCTFVGY CSEVCPKHVD PAAAIQQGKV ESAKDFMIAM       240
     LKPQ                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page