(data stored in ACNUC7421 zone)

EMBL: CP001600.PE362

CP001600.PE362       Location/Qualifiers
FT   CDS             complement(399186..400985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0392"
FT                   /product="fumarate reductase, flavoprotein subunit,
FT                   putative"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67633"
FT                   /db_xref="GOA:C5BDL7"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005884"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDL7"
FT                   /protein_id="ACR67633.2"
FT                   /translation="MQTFNADLAIVGAGGAGLRAAIAAAEANPQLKIALISKVYPMRSH
FT                   TVAAEGGSAAVTQAHDSFDFHFHDTVAGGDWLCEQDVVDHFVHNCPREMTQLELWGCPW
FT                   SRKPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLKYPQIQRFDEHFVLDILV
FT                   DDGQARGVVAINMMEGTMVQIRANAVILATGGAGRVYRYNTNGGIVTGDGMGMAFKHGI
FT                   PLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKDGYRYLQDYGLGPETPLGEPKNK
FT                   YMELGPRDKVSQAFWHEWRAGRTISTPRGDVVYLDLRHLGAKKLHERLPFICELAKAYV
FT                   GVDPVNEPIPVRPTAHYTMGGIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAE
FT                   LVVFGRVAGESALQHLQNVTPTNGTALDAQVKDIEGNLKALVNQEGNENWATLRDEMGT
FT                   SMEEGCGIYRTTDLMQKTVDKLAELKERFKHVKITDTSSVFNTELLYAIELEHGLNVAE
FT                   CMAHSAINRRESRGAHQRLDEGCTERDDVNFLKHTLTYFNESGAPRIEYSDVKITKLPP
FT                   AKRVYGAEAEAQEAKKKEEKANG"
     MQTFNADLAI VGAGGAGLRA AIAAAEANPQ LKIALISKVY PMRSHTVAAE GGSAAVTQAH        60
     DSFDFHFHDT VAGGDWLCEQ DVVDHFVHNC PREMTQLELW GCPWSRKPDG SVNVRRFGGM       120
     KIERTWFAAD KTGFHMLHTL FQTSLKYPQI QRFDEHFVLD ILVDDGQARG VVAINMMEGT       180
     MVQIRANAVI LATGGAGRVY RYNTNGGIVT GDGMGMAFKH GIPLRDMEFV QYHPTGLPGS       240
     GILMTEGCRG EGGILVNKDG YRYLQDYGLG PETPLGEPKN KYMELGPRDK VSQAFWHEWR       300
     AGRTISTPRG DVVYLDLRHL GAKKLHERLP FICELAKAYV GVDPVNEPIP VRPTAHYTMG       360
     GIETDQNCET RIKGLFAVGE CSSVGLHGAN RLGSNSLAEL VVFGRVAGES ALQHLQNVTP       420
     TNGTALDAQV KDIEGNLKAL VNQEGNENWA TLRDEMGTSM EEGCGIYRTT DLMQKTVDKL       480
     AELKERFKHV KITDTSSVFN TELLYAIELE HGLNVAECMA HSAINRRESR GAHQRLDEGC       540
     TERDDVNFLK HTLTYFNESG APRIEYSDVK ITKLPPAKRV YGAEAEAQEA KKKEEKANG        599
//

If you have problems or comments...

PBIL Back to PBIL home page