(data stored in ACNUC7421 zone)

EMBL: CP001600.PE368

CP001600.PE368       Location/Qualifiers
FT   CDS             complement(404571..405614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0398"
FT                   /product="ribosome small subunit-dependent GTPase A,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67639"
FT                   /db_xref="GOA:C5BDM3"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDM3"
FT                   /protein_id="ACR67639.2"
FT                   /translation="MSKKKLSHGQQRRVHTNHQRRLQQTDNSAEMDDSLFGDAQDGIVV
FT                   SRFGKHADVEAADGTQQRCNIRRTLPSLVTGDRVVWRAALQAGSKGIIEAVHPRSSVLT
FT                   RPDYYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLCVEPLIVLNKVDLLDE
FT                   EGREFVEQAMEIYRHIGYRVVLVSSHNGEGIVQLQDRLTQRISIFAGQSGVGKSSLLNA
FT                   LLPTLESQIEVGAVSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLDAEQIT
FT                   QGFIEFRDYLGGCKFRDCKHGNDPGCALREAVERGDIAETRFDNYHRILEGMAQVKLRK
FT                   NFGNGDS"
     MSKKKLSHGQ QRRVHTNHQR RLQQTDNSAE MDDSLFGDAQ DGIVVSRFGK HADVEAADGT        60
     QQRCNIRRTL PSLVTGDRVV WRAALQAGSK GIIEAVHPRS SVLTRPDYYD GVKPIAANID       120
     QIVIVSAILP ELSLNIIDRY LVACETLCVE PLIVLNKVDL LDEEGREFVE QAMEIYRHIG       180
     YRVVLVSSHN GEGIVQLQDR LTQRISIFAG QSGVGKSSLL NALLPTLESQ IEVGAVSDNS       240
     GLGQHTTTAA RLYHFPHGGD VIDSPGVREF GLWHLDAEQI TQGFIEFRDY LGGCKFRDCK       300
     HGNDPGCALR EAVERGDIAE TRFDNYHRIL EGMAQVKLRK NFGNGDS                     347
//

If you have problems or comments...

PBIL Back to PBIL home page