(data stored in ACNUC7421 zone)

EMBL: CP001600.PE369

CP001600.PE369       Location/Qualifiers
FT   CDS             405764..406309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0399"
FT                   /product="exonuclease family protein"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67640"
FT                   /db_xref="GOA:C5BDM4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDM4"
FT                   /protein_id="ACR67640.2"
FT                   /translation="MSASETRLIWIDLEMTGLDPQRDRIIEIATLVTDADLNVLAEGPV
FT                   IALHQDDAQLALMDEWNVRTHTASGLVARVKASQYDDAAAEQATLDFLRQWVPAGVSPI
FT                   CGNSVGQDRRFLFRYMPELERYFHYRYLDVSTLKELARRWKPEILEGFKKRNTHQALDD
FT                   IRESVAELTYYRTHFIQP"
     MSASETRLIW IDLEMTGLDP QRDRIIEIAT LVTDADLNVL AEGPVIALHQ DDAQLALMDE        60
     WNVRTHTASG LVARVKASQY DDAAAEQATL DFLRQWVPAG VSPICGNSVG QDRRFLFRYM       120
     PELERYFHYR YLDVSTLKEL ARRWKPEILE GFKKRNTHQA LDDIRESVAE LTYYRTHFIQ       180
     P                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page