(data stored in ACNUC7421 zone)

EMBL: CP001600.PE371

CP001600.PE371       Location/Qualifiers
FT   CDS             408247..409740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0404"
FT                   /product="YjeF-like protein, C-terminus"
FT                   /note="YjeF homolog, C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67642"
FT                   /db_xref="GOA:C5BDM6"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDM6"
FT                   /protein_id="ACR67642.1"
FT                   /translation="MGHSCNRNIDSLSHYVAPADWVRDAETRAVAAQGIALATLMQRAG
FT                   LAAFNRGRQCYPTSRRWLILCGRGNNGGDGYVIARLARASGLQVTLMAVAGDSPLPPEA
FT                   QQARAQWLQCGGSEIAASLPLPAAEVIVDALLGIGLSSAPRAPYDALISAINAHSAPVL
FT                   SIDLPSGLNADTGAAAGAVVRADHTQSFICLKPGLLTGLARAVVGQLHCDPLGLTVWLA
FT                   QQDWPLQRLDGHCLPRWLAPRSPLAHKGDNGRLLLIGGDSGMGGAIRLAGQAALRSGAG
FT                   LVRVLTRGEHVAPLLAAAPELMVKALSRDTLREALSWAEAVVVGPGLGQGEWGQMVLAA
FT                   LASVRKPMLWDADALNLLSGAPSVCEWRVMTPHPGEAARLLGCGIADVENDRPAAVRAL
FT                   QRRYGGVALLKGAGTLIADDARCAIADVGNPGMASGGMGDILSGIIGGLLAQKLTLYDA
FT                   ACAGAVLHGVAADAAALRDGERGMLASDLLPEIRRWANP"
     MGHSCNRNID SLSHYVAPAD WVRDAETRAV AAQGIALATL MQRAGLAAFN RGRQCYPTSR        60
     RWLILCGRGN NGGDGYVIAR LARASGLQVT LMAVAGDSPL PPEAQQARAQ WLQCGGSEIA       120
     ASLPLPAAEV IVDALLGIGL SSAPRAPYDA LISAINAHSA PVLSIDLPSG LNADTGAAAG       180
     AVVRADHTQS FICLKPGLLT GLARAVVGQL HCDPLGLTVW LAQQDWPLQR LDGHCLPRWL       240
     APRSPLAHKG DNGRLLLIGG DSGMGGAIRL AGQAALRSGA GLVRVLTRGE HVAPLLAAAP       300
     ELMVKALSRD TLREALSWAE AVVVGPGLGQ GEWGQMVLAA LASVRKPMLW DADALNLLSG       360
     APSVCEWRVM TPHPGEAARL LGCGIADVEN DRPAAVRALQ RRYGGVALLK GAGTLIADDA       420
     RCAIADVGNP GMASGGMGDI LSGIIGGLLA QKLTLYDAAC AGAVLHGVAA DAAALRDGER       480
     GMLASDLLPE IRRWANP                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page